PTM Viewer PTM Viewer

AT3G42830.1

Arabidopsis thaliana [ath]

RING/U-box superfamily protein

No PTMs currently found

PLAZA: AT3G42830
Gene Family: HOM05D001662
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 115

MASLNSDVIMGESSSISVPSSSSKNSKRFELKKWSAVALWAWDIVVDNCAICRNHIMDLCIECLANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDVCEWEFQKYGH

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR001841 60 104
IPR024766 47 104
Sites
Show Type Position
Active Site 49
Active Site 52
Active Site 87
Active Site 60
Active Site 63
Active Site 75
Active Site 89
Active Site 82
Active Site 84
Active Site 101
Active Site 104

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here